Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH |
Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD |
Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR |
Rabbit Polyclonal Anti-HK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR |
Rabbit Polyclonal Anti-PGM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: TVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRL |
Rabbit Polyclonal Anti-PGM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI |
Rabbit Polyclonal Anti-PFKL Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKL antibody: synthetic peptide directed towards the middle region of human PFKL. Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA |
Rabbit Polyclonal Anti-HK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HK1 antibody: synthetic peptide directed towards the middle region of human HK1. Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR |
Rabbit Polyclonal Anti-HK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HK1 antibody: synthetic peptide directed towards the N terminal of human HK1. Synthetic peptide located within the following region: CQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVV |
Rabbit Polyclonal Anti-PFKM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA |
Mouse Monoclonal AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Hexokinase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Hexokinase II Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac6 Clone 4E10 10.2
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac10 Clone 6G11
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac9 Clone 3B6.1/2.F11
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac5 Clone 3G5.1/2.G6
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac4 Clone 7C10-7.1
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac3 Clone 4C9 1.2
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mbbm1 Clone VA4-20B
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac8 Clone 3F4 G5E3
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
USD 1,140.00
2 Weeks
Mouse monoclonal Anti-a-Lactalbumin Clone F20.16
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-GCK Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 3-17 amino acids of Human glucokinase (hexokinase 4) |
Anti-AKR1B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-AKR1B1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase) |
Anti-AKR1B1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase) |
Rabbit Polyclonal Anti-PFKP Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PFKP |
Germany
Japan
United Kingdom
China
