Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 18 of 18 results

(reset)

PGM3 Rabbit Polyclonal Antibody

TA345110

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGM3 Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PGM3 antibody: synthetic peptide directed towards the middle region of human PGM3. Synthetic peptide located within the following region: GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN

PGM3 Rabbit Polyclonal Antibody

TA345111

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGM3 Antibody - N-terminal region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PGM3 antibody: synthetic peptide directed towards the N terminal of human PGM3. Synthetic peptide located within the following region: IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL

PGM3 Rabbit Polyclonal Antibody

TA308127

USD 415.00

5 Days

Rabbit Polyclonal antibody to PGM3 (phosphoglucomutase 3)

Applications	IF, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 44 and 321 of PGM3 (Uniprot ID#O95394)

1 / 3

2 / 3

3 / 3

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

CF504859

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PGM3 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI1B8]

CF504860

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PGM3 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI5C6]

CF504940

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PGM3 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

TA504859

USD 379.00

In Stock

PGM3 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

PGM3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]

TA504859AM

USD 420.00

4 Weeks

PGM3 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

PGM3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A11]

TA504859BM

USD 420.00

4 Weeks

PGM3 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

TA504859S

USD 159.00

2 Days

PGM3 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI1B8]

TA504860

USD 379.00

In Stock

PGM3 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PGM3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]

TA504860AM

USD 420.00

5 Days

PGM3 mouse monoclonal antibody,clone 1B8, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PGM3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]

TA504860BM

USD 420.00

5 Days

PGM3 mouse monoclonal antibody,clone 1B8, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI1B8]

TA504860S

USD 159.00

2 Days

PGM3 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI5C6]

TA504940

USD 379.00

In Stock

PGM3 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PGM3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C6]

TA504940AM

USD 420.00

5 Days

PGM3 mouse monoclonal antibody,clone 5C6, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

PGM3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C6]

TA504940BM

USD 420.00

5 Days

PGM3 mouse monoclonal antibody,clone 5C6, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

PGM3 Mouse Monoclonal Antibody [Clone ID: OTI5C6]

TA504940S

USD 159.00

2 Days

PGM3 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 18 of 18 results