Rabbit polyclonal anti-ARG2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARG2. |
Rabbit polyclonal anti-ARG2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARG2. |
Rabbit Polyclonal Anti-ARG2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the N terminal of human ARG2. Synthetic peptide located within the following region: LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH |
Rabbit Polyclonal Anti-ARG2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the C terminal of human ARG2. Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT |
Carrier-free (BSA/glycerol-free) ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Biotin |
ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | HRP |
ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".