Antibodies

Jump to Filters
View as table Download
ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody
AP20289PU-N

USD 370.00

2 Weeks

ATP citrate lyase (ACLY) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 430-480 of Human ATP-Citrate synthase.
ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody
TA329520

USD 375.00

5 Days

Rabbit Polyclonal anti-ACLY antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI
ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody
TA329521

USD 375.00

5 Days

Rabbit Polyclonal anti-ACLY antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA
ATP citrate lyase (ACLY) Mouse Monoclonal Antibody [Clone ID: OTI3G8]
CF501031

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACLY mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody
TA349692

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACLY Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACLY
ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody
TA349693

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACLY Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACLY
ATP citrate lyase (ACLY) Mouse Monoclonal Antibody [Clone ID: OTI3G8]
TA501031

USD 379.00

In Stock

Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ATP citrate lyase (ACLY) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G8]
TA501031AM

USD 420.00

4 Weeks

Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
ATP citrate lyase (ACLY) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G8]
TA501031BM

USD 420.00

4 Weeks

Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
ATP citrate lyase (ACLY) Mouse Monoclonal Antibody [Clone ID: OTI3G8]
TA501031S

USD 159.00

In Stock

Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".