Antibodies

Jump to Filters
View as table Download
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
TA346659

USD 475.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
TA346660

USD 475.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
Hsc70 (HSPA8) Goat Polyclonal Antibody
TA302666

USD 375.00

5 Days

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: BB70]
TA309384

USD 430.00

2 Weeks

Mouse Monoclonal anti-Hsc70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
TA332519

USD 345.00

In Stock

Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA8
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
TA326279

USD 345.00

In Stock

Rabbit polyclonal HSPA8 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HSPA8.
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: 1F2-H5]
TA326362

USD 445.00

In Stock

Mouse monoclonal anti-HSPA8(HSC70) antibody, clone 1F2-H5, Loading control

Applications WB
Reactivities Human, Mouse, Rat. Not yet tested in other species
Conjugation Unconjugated
Hsc70 (HSPA8) Rabbit Polyclonal Antibody
AP00035PU-N

USD 395.00

3 Weeks

Hsc70 (HSPA8) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Porcine, Rat, Sheep
Immunogen Synthetic peptide surrounding amino acid 559 of human Hsc70
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: 1F2-H5]
TA309355

USD 240.00

5 Days

Mouse Monoclonal anti-HSPA8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: BB70]
TA309383

USD 235.00

2 Weeks

Mouse Monoclonal anti-Hsc70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated
Hsc70 (HSPA8) Rabbit Polyclonal Antibody [Clone ID: N/A]
TA326363

USD 375.00

5 Days

Rabbit polyclonal Hsc70 (Hsp73) Antibody

Applications IF, WB
Reactivities Hamster, Human, Rat
Conjugation Unconjugated
Immunogen Amino acids 618-637 of human hsc70
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]
CF505966

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]
TA505966

USD 379.00

In Stock

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]
TA505966S

USD 159.00

2 Days

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".