Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Rabbit polyclonal anti-AKT antibody
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Rabbit polyclonal Akt2 (PKB beta) Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | A five residue synthetic peptide based on the human Akt2, coupled to KLH |
Rabbit Polyclonal MEK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 200-250, containing phospho serine residues at positions 218 and 222, of human MEK1 was used as the immunogen. |
Rabbit Polyclonal Anti-WASF3 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the N terminal of human WASF3. Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK |
Rabbit Polyclonal Anti-WASF3 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the middle region of human WASF3. Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS |
Rabbit anti ERK1/2 (P44-MAPK) (pT202/pY204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, ChiChickenen |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- with the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit anti ERK1/2 (P44-MAPK) (PairedT202/Y204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- without the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins |
Rabbit anti ERK1/2 (P44-MAPK) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal sequence of ERK1/2 protein from human, rat, mouse and dog origins. |
Germany
Japan
United Kingdom
China
