Antibodies

View as table Download

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

Mouse Monoclonal GAPDH/G3PDH Antibody (13H12)

Applications IHC, WB
Reactivities Human, Mouse, Drosophila, Primate
Conjugation Unconjugated

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Rabbit Polyclonal GAPDH/G3PDH Antibody

Applications WB
Reactivities Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa
Conjugation Unconjugated
Immunogen Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen.