Antibodies

View as table Download

Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

Rabbit anti-PPP1CA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CA

Mouse Monoclonal PPP1A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal PPP1A Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-PPP1CA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Carrier-free (BSA/glycerol-free) PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated