Antibodies

View as table Download

Rabbit polyclonal anti-ARG2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ARG2.

Rabbit Polyclonal Anti-ARG2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the N terminal of human ARG2. Synthetic peptide located within the following region: LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH

Rabbit Polyclonal Anti-ARG2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the C terminal of human ARG2. Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT

Carrier-free (BSA/glycerol-free) ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications WB
Reactivities Human
Conjugation Unconjugated

ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Biotin

ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation HRP

ARG2 mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated

ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

ARG2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications WB
Reactivities Human
Conjugation Unconjugated