Antibodies

View as table Download

Rabbit Polyclonal Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH2 antibody: synthetic peptide directed towards the middle region of human IDH2. Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Rabbit Polyclonal antibody to IDH2 (isocitrate dehydrogenase 2 (NADP+), mitochondrial)

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment corresponding to a region within amino acids 56 and 345 of IDH2 (Uniprot ID#P48735)

Goat Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CIHGLSNVKLNE, from the internal region of the protein sequence according to NP_002159.2.

Rabbit Polyclonal IDH2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.

IDH2 mouse monoclonal antibody, clone 5F11

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal IDH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human IDH2 protein (between residues 375-452) [UniProt P48735].

Rabbit Polyclonal Anti-IDH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IDH2