OR4Q3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 277-307 amino acids from the C-terminal region of human Olfactory receptor 4Q3 |
OR4Q3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 277-307 amino acids from the C-terminal region of human Olfactory receptor 4Q3 |
Rabbit Polyclonal Anti-OR4Q3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR4Q3 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4Q3. Synthetic peptide located within the following region: CVFIYLRPFCSFSVDKIFSLFYTVITPMLNPLIYTLRNTDMKTAMKKLRI |