Antibodies

View as table Download

Rabbit polyclonal anti-Fbp5A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the amino terminal end of human Fbp5A protein.

Emi1 (FBXO5) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 191-221 amino acids from the Central region of Human FBXO5.

Rabbit Polyclonal Anti-FBXO5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO5 antibody: synthetic peptide directed towards the C terminal of human FBXO5. Synthetic peptide located within the following region: ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL