Antibodies

View as table Download

Rabbit anti-ALDH3A1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH3A1

ALDH3A1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ALDH3A1 antibody was raised against aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1.

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the C terminal of human ALDH3A1. Synthetic peptide located within the following region: KFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRI

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI

Rabbit Polyclonal Aldh3A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1.

Carrier-free (BSA/glycerol-free) ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ALDH3A1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1

Anti-ALDH3A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".