Antibodies

View as table Download

FZR1 mouse monoclonal antibody, clone 4C4, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-FZR1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1. Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN