Antibodies

Jump to Filters
View as table Download
Lactate Dehydrogenase B (LDHB) Rabbit Polyclonal Antibody
TA346572

USD 475.00

5 Days

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
Lactate Dehydrogenase B (LDHB) Goat Polyclonal Antibody
TA329084

USD 375.00

5 Days

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Internal region (near C terminus) (NARGLTSVINQKLK)
LDHB Mouse Monoclonal Antibody [Clone ID: AT14D7]
AM50625PU-N

USD 340.00

2 Weeks

LDHB mouse monoclonal antibody, clone AT14D7, Purified

Applications ELISA, WB
Reactivities Human
LDHB Mouse Monoclonal Antibody [Clone ID: AT14D7]
AM50625PU-S

USD 230.00

2 Weeks

LDHB mouse monoclonal antibody, clone AT14D7, Purified

Applications ELISA, WB
Reactivities Human
Lactate Dehydrogenase B (LDHB) Rabbit Polyclonal Antibody
TA324032

USD 345.00

4 Weeks

Anti-LDHB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide (KLH-coupled) derived from human LDHB
Lactate Dehydrogenase B (LDHB) Goat Polyclonal Antibody
TA327769

USD 375.00

5 Days

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (near N terminus) (EEATVPNNKIT)