Germany
Japan
United Kingdom
China
Rabbit Polyclonal LGP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LGP2 antibody was raised against a 11 amino acid peptide from near the center of human LGP2. |
Antibodies
View as table Download
Goat Anti-LGP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DFLQHCAENLSD, from the C Terminus of the protein sequence according to NP_077024.2. |
Rabbit Polyclonal LGP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LGP2 antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human LGP2. |
Rabbit Polyclonal LGP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LGP2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human LGP2. |
Rabbit Polyclonal Anti-DHX58 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX58 antibody: synthetic peptide directed towards the N terminal of human DHX58. Synthetic peptide located within the following region: AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM |
Active filters
Target Symbol
- DHX58
Reactivities
- Human
Pathways
- RIG-I-like receptor signaling pathway