Rabbit anti-JNK2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human JNK2 |
Rabbit anti-JNK2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human JNK2 |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
JNK2 (MAPK9) (1-425) mouse monoclonal antibody, clone 1C1-3A8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK2 (MAPK9) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-MAPK9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 373-386 amino acids of Human mitogen-activated protein kinase 9 |
Anti-MAPK9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 373-386 amino acids of Human mitogen-activated protein kinase 9 |
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 2H3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 2H3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 2D11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 2D11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 2G3, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 2G3, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 4D1, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 4D1, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | HRP |
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 1A1, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
MAPK9 mouse monoclonal antibody,clone 1A1, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".