Germany
Japan
United Kingdom
China
HSPA1L Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HSPA1L |
Antibodies
View as table Download
Rabbit Polyclonal Anti-HSPA1L Antibody
| Applications | WB |
| Reactivities | Human, Lamprey, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI1F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI2H3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI3B10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI3B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI1G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSPA1L mouse monoclonal antibody,clone OTI1F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA1L mouse monoclonal antibody,clone OTI1F12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
HSPA1L mouse monoclonal antibody,clone OTI1F12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
HSPA1L mouse monoclonal antibody,clone OTI1F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HSPA1L mouse monoclonal antibody,clone OTI2H3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA1L mouse monoclonal antibody,clone OTI2H3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
HSPA1L mouse monoclonal antibody,clone OTI2H3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
HSPA1L mouse monoclonal antibody,clone OTI2H3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HSPA1L mouse monoclonal antibody,clone OTI3B10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA1L mouse monoclonal antibody,clone OTI3B10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
HSPA1L mouse monoclonal antibody,clone OTI3B10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
HSPA1L mouse monoclonal antibody,clone OTI3B10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HSPA1L mouse monoclonal antibody,clone OTI3B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA1L mouse monoclonal antibody,clone OTI3B5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
HSPA1L mouse monoclonal antibody,clone OTI3B5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
HSPA1L mouse monoclonal antibody,clone OTI3B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HSPA1L mouse monoclonal antibody,clone OTI1G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA1L mouse monoclonal antibody,clone OTI1G8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
HSPA1L mouse monoclonal antibody,clone OTI1G8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
HSPA1L mouse monoclonal antibody,clone OTI1G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- HSPA1L
Pathways
- Spliceosome