Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HSPA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV |
Carrier-free (BSA/glycerol-free) HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
HSPA6 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- HSPA6
Pathways
- Spliceosome