Antibodies

View as table Download

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Rabbit Polyclonal antibody to ARF1 (ADP-ribosylation factor 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 162 of ARF1 (Uniprot ID#P84077)

ARF1 mouse monoclonal antibody, clone AT1B3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

ARF1 mouse monoclonal antibody, clone AT1B3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

Rabbit Polyclonal antibody to ARF1 (ADP-ribosylation factor 1)

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 50 and 104 of ARF1

Goat Polyclonal Antibody against ARF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGLDWLSNQLRNQK, from the C Terminus of the protein sequence according to NP_001019397.1; NP_001649.1; NP_001019398.1; NP_001019399.1.

Anti-ARF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 100-115 amino acids of Human ADP-ribosylation factor 1

ARF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated