Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 38 of 38 results

(reset)

TP53

AB0065-200

USD 320.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications	IF, WB
Reactivities	Canine, Human, Monkey, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA327567

USD 345.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human TP53

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TP53

AB0154-200

USD 320.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications	IF, WB
Reactivities	Canine, Human, Monkey, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA325951

USD 345.00

In Stock

Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20
Modifications	Phospho-specific

p53 (TP53) Rabbit Polyclonal Antibody

TA347810

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p53 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

p53 (TP53) Rabbit Polyclonal Antibody

TA347816

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p53 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

p53 (TP53) Rabbit Polyclonal Antibody

TA347818

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p53 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

p53 (TP53) Rabbit Polyclonal Antibody

TA324776

USD 450.00

5 Days

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications	Dot, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA326103

USD 345.00

In Stock

Rabbit polyclonal p53 antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human p53.

p53 (TP53) Rabbit Polyclonal Antibody

TA326192

USD 345.00

In Stock

Rabbit polyclonal p53 (Ab-378) antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H).

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA325948

USD 345.00

4 Weeks

Rabbit Polyclonal p53 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against A synthesized peptide derived from human p53

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: Pab 240]

TA336582

USD 457.00

5 Days

Mouse Monoclonal p53 Antibody (PAb 240)

Applications	WB
Reactivities	Human, Mouse, Rat, Yeast (Does not react with: Xenopus)
Conjugation	Unconjugated

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354205

USD 300.00

5 Days

Rabbit anti p53 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the N-terminus of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354509

USD 325.00

5 Days

Rabbit anti P53(pS15) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354572

USD 355.00

5 Days

Rabbit anti P53(pS37) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA342298

USD 310.00

5 Days

Rabbit Polyclonal Anti-TRP53 Antibody

Applications	WB
Reactivities	Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TRP53 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: S20]

TA354364

USD 355.00

5 Days

Mouse anti p53 Monoclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

CF502783

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5E2]

CF502870

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

CF502987

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

CF503035

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA321153

USD 345.00

In Stock

Anti-TP53 Rabbit Polyclonal Antibody

Applications	ELISA, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

TA502783

USD 379.00

In Stock

TP53 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

TA502783AM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E4]

TA502783BM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

TA502783S

USD 159.00

2 Days

TP53 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5E2]

TA502870

USD 379.00

In Stock

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E2]

TA502870AM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E2]

TA502870BM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5E2]

TA502870S

USD 159.00

In Stock

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

TA502987

USD 379.00

In Stock

TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D11]

TA502987AM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D11]

TA502987BM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

TA502987S

USD 159.00

2 Days

TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

TA503035

USD 379.00

In Stock

TP53 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

TA503035AM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]

TA503035BM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

TA503035S

USD 159.00

2 Days

TP53 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 38 of 38 results