Antibodies

View as table Download

PIM2 Antibody (C-term ) Rabbit Polyclonal Antibody (Pab)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PIM2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-308 amino acids from the C-terminal region of human PIM2.

Rabbit Polyclonal antibody to PIM2 (pim-2 oncogene)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 53 and 278 of PIM2 (Uniprot ID#Q9P1W9)

Rabbit Polyclonal Anti-PIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIM2 antibody: synthetic peptide directed towards the middle region of human PIM2. Synthetic peptide located within the following region: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW

Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI8G10 (formerly 8G10)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIM2 mouse monoclonal antibody, clone OTI9A5 (formerly 9A5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PIM2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PIM2

PIM2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse PIM2

PIM2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PIM2

Anti-PIM2 mouse monoclonal antibody, clone OTI8G10 (formerly 8G10)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PIM2 mouse monoclonal antibody, clone 8G10, Biotinylated

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PIM2 mouse monoclonal antibody, clone 8G10, HRP conjugated

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-PIM2 mouse monoclonal antibody, clone OTI8G10 (formerly 8G10)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PIM2 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-PIM2 mouse monoclonal antibody, clone OTI8B4 (formerly 8B4)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-PIM2 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-PIM2 mouse monoclonal antibody, clone OTI10A12 (formerly 10A12)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-PIM2 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PIM2 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-PIM2 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-PIM2 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-PIM2 mouse monoclonal antibody, clone OTI9A5 (formerly 9A5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PIM2 mouse monoclonal antibody, clone OTI9A5 (formerly 9A5), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-PIM2 mouse monoclonal antibody, clone OTI9A5 (formerly 9A5), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-PIM2 mouse monoclonal antibody, clone OTI9A5 (formerly 9A5)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".