Rabbit Polyclonal Anti-CAND1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAND1 antibody: synthetic peptide directed towards the middle region of human CAND1. Synthetic peptide located within the following region: AALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS |
Rabbit Polyclonal Anti-CAND1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIP120A antibody: synthetic peptide directed towards the N terminal of human TIP120A. Synthetic peptide located within the following region: TVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADM |
CAND1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CAND1 |
CAND1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 750-980 of human CAND1 (NP_060918.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
