Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to Coronin 1B (coronin, actin binding protein, 1B)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 213 of Coronin 1B (Uniprot ID#Q9BR76) |
Rabbit Polyclonal Anti-CORO1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CORO1B Antibody is: synthetic peptide directed towards the C-terminal region of Human CORO1B. Synthetic peptide located within the following region: STTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ |
CORO1B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CORO1B |
CORO1B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CORO1B |
USD 420.00
4 Weeks
Anti-CORO1B (Coronin 1b) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- CORO1B
Reactivities
- Human