Anti-ID2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.5~9(S-P-V-R-S) derived from Human Id2. |
Anti-ID2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.5~9(S-P-V-R-S) derived from Human Id2. |
Rabbit Polyclonal Anti-ID2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ID2 antibody: synthetic peptide directed towards the middle region of human ID2. Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC |
Carrier-free (BSA/glycerol-free) ID2 mouse monoclonal antibody, clone OTI10C3 (formerly 10C3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ID2 mouse monoclonal antibody, clone OTI9A8 (formerly 9A8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ID2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ID2 |
Rabbit Polyclonal Anti-ID2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ID2 |
ID2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ID2 |
ID2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ID2 |
ID2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2). |
Modifications | Unmodified |
ID2 mouse monoclonal antibody, clone OTI10C3 (formerly 10C3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ID2 mouse monoclonal antibody, clone 10C3, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ID2 mouse monoclonal antibody, clone 10C3, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ID2 mouse monoclonal antibody, clone OTI10C3 (formerly 10C3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ID2 mouse monoclonal antibody, clone OTI9A8 (formerly 9A8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ID2 mouse monoclonal antibody, clone OTI9A8 (formerly 9A8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ID2 mouse monoclonal antibody, clone OTI9A8 (formerly 9A8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ID2 mouse monoclonal antibody, clone OTI9A8 (formerly 9A8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".