Germany
Japan
United Kingdom
China
Anti-ID2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.5~9(S-P-V-R-S) derived from Human Id2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ID2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ID2 antibody: synthetic peptide directed towards the middle region of human ID2. Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC |
ID2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2). |
| Modifications | Unmodified |
ID2 mouse monoclonal antibody, clone OTI10C3 (formerly 10C3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ID2 mouse monoclonal antibody, clone OTI9A8 (formerly 9A8)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ID2
Reactivities
- Human