MBL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MBL2 |
MBL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MBL2 |
Rabbit anti-MBL2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MBL2 |
Rabbit polyclonal anti-MBL2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MBL2. |
Rabbit Polyclonal Anti-MBL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MBL2 antibody: synthetic peptide directed towards the middle region of human MBL2. Synthetic peptide located within the following region: KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MBL2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human MBL2 |
MBL2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MBL2 |
USD 379.00
In Stock
MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |