Antibodies

View as table Download

Rabbit Polyclonal Anti-PON3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PON3 antibody: synthetic peptide directed towards the middle region of human PON3. Synthetic peptide located within the following region: PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY

Rabbit Polyclonal Anti-PON3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PON3 antibody: synthetic peptide directed towards the middle region of human PON3. Synthetic peptide located within the following region: FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody,clone OTI1A5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody,clone OTI1B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PON3 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications WB
Reactivities Human
Conjugation Unconjugated

PON3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PON3 (NP_000931.1).
Modifications Unmodified

PON3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

PON3 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

PON3 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody,clone OTI1A5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody,clone OTI1A5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody,clone OTI1B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody,clone OTI1B12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications WB
Reactivities Human
Conjugation Unconjugated

PON3 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

PON3 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

PON3 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications WB
Reactivities Human
Conjugation Unconjugated