Antibodies

View as table Download

Goat Anti-AGTPBP1 / NNA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TSPLEYNLPS, from the internal region of the protein sequence according to NP_056054.2.

Rabbit Polyclonal Anti-AGTPBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AGTPBP1 Antibody: synthetic peptide directed towards the N terminal of human AGTPBP1. Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI

Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9B8 (formerly 9B8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9D11 (formerly 9D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-520 of human AGTPBP1 (NP_056054.2).
Modifications Unmodified

AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody,clone 1C8, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody, clone OTI9B8 (formerly 9B8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody, clone OTI9B8 (formerly 9B8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody, clone OTI9D11 (formerly 9D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody, clone OTI9D11 (formerly 9D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGTPBP1 mouse monoclonal antibody,clone 9C8, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated