GIPC1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GIPC1 |
GIPC1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GIPC1 |
Rabbit Polyclonal Anti-GIPC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GIPC1 antibody: synthetic peptide directed towards the N terminal of human GIPC1. Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA |
Rabbit Polyclonal antibody to GIPC1 (GIPC PDZ domain containing family, member 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 273 and 333 of GIPC1 |
Goat Polyclonal Antibody against GIPC1 / NIP
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GAIGDAKVGRY, from the C Terminus of the protein sequence according to NP_005707.1; NP_974197.1; NP_974199.1; NP_974196.1; NP_974198.1; NP_974223.1. |
Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI4C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI5C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GIPC1 mouse monoclonal antibody,clone OTI6A6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GIPC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GIPC1 |
GIPC1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GIPC1 |
GIPC1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-333 of human GIPC1 (NP_005707.1). |
Modifications | Unmodified |
GIPC1 mouse monoclonal antibody,clone OTI4C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GIPC1 mouse monoclonal antibody,clone OTI4C11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GIPC1 mouse monoclonal antibody,clone OTI4C11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GIPC1 mouse monoclonal antibody,clone OTI4C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GIPC1 mouse monoclonal antibody,clone OTI5C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
GIPC1 mouse monoclonal antibody,clone OTI5C10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
2 Weeks
GIPC1 mouse monoclonal antibody,clone OTI5C10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GIPC1 mouse monoclonal antibody,clone OTI5C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GIPC1 mouse monoclonal antibody,clone OTI6A6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
GIPC1 mouse monoclonal antibody,clone OTI6A6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
2 Weeks
GIPC1 mouse monoclonal antibody,clone OTI6A6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GIPC1 mouse monoclonal antibody,clone OTI6A6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |