Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI |
Rabbit polyclonal Anti-KV7.2 (KCNQ2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RGPTITDKDRTKGPAE, corresponding to amino acid residues 578-593 of rat KCNQ2 . Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: YRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFL |
KCNQ2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human KCNQ2 |
KCNQ2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 254-393 of human KCNQ2 (NP_742107.1). |
| Modifications | Unmodified |
Phospho-KCNQ2/3/4/5 (Thr217/Thr246/Thr223/Thr251) Rabbit polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of Thr246. AA range:191-240 (Phosphorylated) |
Active filters
Target Symbol
- KCNQ2
Reactivities
- Human