Rabbit Polyclonal anti-LRRC2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRRC2 antibody: synthetic peptide directed towards the N terminal of human LRRC2. Synthetic peptide located within the following region: GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA |
Rabbit Polyclonal anti-LRRC2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRRC2 antibody: synthetic peptide directed towards the C terminal of human LRRC2. Synthetic peptide located within the following region: NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ |
LRRC2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human LRRC2 |
Germany
Japan
United Kingdom
China
