Antibodies

Jump to Filters
View as table Download
LTBR Rabbit Polyclonal Antibody
TA332629

USD 275.00

2 Weeks

Rabbit anti-LTBR Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LTBR
LTBR Rabbit Polyclonal Antibody
TA314162

USD 345.00

In Stock

Rabbit polyclonal anti-LTBR antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LTBR.
LTBR Rabbit Polyclonal Antibody
TA329151

USD 375.00

5 Days

Rabbit Polyclonal anti-LTBR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY
LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]
CF805712

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications WB
Reactivities Human
Conjugation Unconjugated
LTBR Rabbit Polyclonal Antibody
TA361312

USD 360.00

5 Days

LTBR Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LTBR
LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]
TA805712

USD 379.00

In Stock

LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications WB
Reactivities Human
Conjugation Unconjugated
LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]
TA805712S

USD 159.00

2 Days

LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications WB
Reactivities Human
Conjugation Unconjugated