Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ORAI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORAI2 antibody: synthetic peptide directed towards the middle region of human ORAI2. Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ |
Carrier-free (BSA/glycerol-free) ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ORAI2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ORAI2
Reactivities
- Human