Antibodies

View as table Download

Mouse Monoclonal Anti-Piccolo Antibody

Applications WB
Reactivities Human, Rat. Other species not yet tested
Conjugation Unconjugated

Rabbit Polyclonal Anti-Piccolo Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat. Not yet tested on other species
Conjugation Unconjugated
Immunogen Full length protein

Rabbit Polyclonal Anti-PCLO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCLO antibody is: synthetic peptide directed towards the C-terminal region of Human PCLO. Synthetic peptide located within the following region: SHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTSVT