Antibodies

Jump to Filters
View as table Download
CTIP1 (BCL11A) Rabbit Polyclonal Antibody
TA332690

USD 275.00

3 Weeks

Rabbit anti-BCL11A Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BCL11A
Bcl11a Rabbit Polyclonal Antibody
TA329189

USD 375.00

5 Days

Rabbit Polyclonal anti-Bcl11a Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Bcl11a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Bcl11a. Synthetic peptide located within the following region: GLRIYLESEHGSPLTPRVLHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL