Rabbit Polyclonal Anti-Gcm1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gcm1 antibody: synthetic peptide directed towards the middle region of mouse Gcm1. Synthetic peptide located within the following region: EDPTSTLDSMKFYERCKFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKN |
Rabbit Polyclonal Anti-Gcm1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gcm1 antibody: synthetic peptide directed towards the N terminal of mouse Gcm1. Synthetic peptide located within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA |
Germany
Japan
United Kingdom
China