Rabbit Polyclonal Anti-GCM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCM1 antibody: synthetic peptide directed towards the N terminal of human GCM1. Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK |
Rabbit Polyclonal Anti-GCM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCM1 antibody: synthetic peptide directed towards the C terminal of human GCM1. Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG |
Rabbit Polyclonal Anti-Gcm1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gcm1 antibody: synthetic peptide directed towards the middle region of mouse Gcm1. Synthetic peptide located within the following region: EDPTSTLDSMKFYERCKFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKN |
Rabbit Polyclonal Anti-Gcm1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gcm1 antibody: synthetic peptide directed towards the N terminal of mouse Gcm1. Synthetic peptide located within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA |
Carrier-free (BSA/glycerol-free) GCM1 mouse monoclonal antibody,clone OTI4E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GCM1 mouse monoclonal antibody,clone OTI4H6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GCM1 mouse monoclonal antibody,clone OTI1A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GCM1 mouse monoclonal antibody,clone OTI5F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GCM1 mouse monoclonal antibody,clone OTI1A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GCM1 mouse monoclonal antibody,clone OTI5A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GCM1 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GCM1 mouse monoclonal antibody,clone OTI4D2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI4E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI4E2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GCM1 mouse monoclonal antibody,clone OTI4E2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GCM1 mouse monoclonal antibody,clone OTI4E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI4H6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI4H6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GCM1 mouse monoclonal antibody,clone OTI4H6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GCM1 mouse monoclonal antibody,clone OTI4H6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI1A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI1A5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GCM1 mouse monoclonal antibody,clone OTI1A5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GCM1 mouse monoclonal antibody,clone OTI1A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI5F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI5F9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GCM1 mouse monoclonal antibody,clone OTI5F9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GCM1 mouse monoclonal antibody,clone OTI5F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI1A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI1A4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GCM1 mouse monoclonal antibody,clone OTI1A4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GCM1 mouse monoclonal antibody,clone OTI1A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI5A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI5A5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GCM1 mouse monoclonal antibody,clone OTI5A5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GCM1 mouse monoclonal antibody,clone OTI5A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI1F4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GCM1 mouse monoclonal antibody,clone OTI1F4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GCM1 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI4D2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCM1 mouse monoclonal antibody,clone OTI4D2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GCM1 mouse monoclonal antibody,clone OTI4D2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GCM1 mouse monoclonal antibody,clone OTI4D2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
