GCM1 Rabbit Polyclonal Antibody

CAT#: TA330093

Rabbit Polyclonal Anti-GCM1 Antibody

Product Images

WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:7812500; Positive Control: Human Placenta

• 

  Human 293T

• 

  Human Lung

• 

  Human Spleen

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GCM1 antibody: synthetic peptide directed towards the N terminal of human GCM1. Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: glial cells missing homolog 1
• Database Link:
  NP_003634
  Entrez Gene 8521 Human
  UniProt ID Q9NP62
• Background: GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-132 D88613.1 1-132 133-2763 AB026493.1 1-2631
• Synonyms: GCMA; hGCMa
• Note: Immunogen sequence homology: Human: 92%; Dog: 78%; Mouse: 78%; Rat: 78%

Reference Data

• Protein Families: Transcription Factors