GCM1 Rabbit Polyclonal Antibody

CAT#: TA341768

Rabbit Polyclonal Anti-Gcm1 Antibody

Product Images

WB Suggested Anti-Gcm1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Gcm1 antibody: synthetic peptide directed towards the N terminal of mouse Gcm1. Synthetic peptide located within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: glial cells missing homolog 1
• Database Link:
  NP_003634
  Entrez Gene 14531 Mouse
  UniProt ID Q9NP62
• Background: Transcription factor that is necessary for placental development
• Synonyms: GCMA; hGCMa
• Note: Immunogen Sequence Homology: Mouse: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 86%; Human: 86%; Zebrafish: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors