GCM1 Rabbit Polyclonal Antibody

CAT#: TA330094

Rabbit Polyclonal Anti-GCM1 Antibody

Product Images

WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GCM1 antibody: synthetic peptide directed towards the C terminal of human GCM1. Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: glial cells missing homolog 1
• Database Link:
  NP_003634
  Entrez Gene 8521 Human
  UniProt ID Q9NP62
• Background: GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
• Synonyms: GCMA; hGCMa
• Note: Immunogen sequence homology: Human: 100%; Horse: 92%; Dog: 90%; Rabbit: 81%

Reference Data

• Protein Families: Transcription Factors