Rabbit Polyclonal Anti-KLF11 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KLF11 |
Rabbit Polyclonal Anti-KLF11 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KLF11 |
Rabbit polyclonal TIEG2 Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TIEG2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-36 amino acids from the N-terminal region of human TIEG2. |
Rabbit Polyclonal Anti-KLF11 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLF11 Antibody: A synthesized peptide derived from human KLF11 |
Rabbit polyclonal anti-KLF11 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human KLF11. |
Rabbit polyclonal anti-Klf11 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Klf11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH |
KLF11 rabbit polyclonal antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KLF11 |
KLF11 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KLF11. |