Rabbit Polyclonal Anti-Rel Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rel antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF |
Rabbit anti Rel (pS503) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -CSVNMMTTS-S-DSMGETD- with phosphorylation sites at Ser503 of c-Rel protein from human. |
REL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human REL (NP_002899.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
