Antibodies

Jump to Filters
View as table Download
HMGCL Rabbit Polyclonal Antibody
TA336239

USD 375.00

5 Days

Rabbit Polyclonal Anti-Hmgcl Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL
HMGCL Rabbit Polyclonal Antibody
TA350049

USD 345.00

In Stock

Rabbit Polyclonal Anti-HMGCL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMGCL
HMGCL Rabbit Polyclonal Antibody
TA364832

USD 380.00

4 Weeks

HMGCL rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMGCL
HMGCL Rabbit Polyclonal Antibody
TA377136

USD 220.00

3 Weeks

HMGCL Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human HMGCL (NP_000182.2).
Modifications Unmodified