Antibodies

Jump to Filters
View as table Download
C19orf18 (Center) Rabbit Polyclonal Antibody
AP50510PU-N

USD 450.00

2 Weeks

C19orf18 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 147~176 amino acids from the Central region of human C19orf18
C19orf18 Rabbit Polyclonal Antibody
TA338862

USD 375.00

5 Days

Rabbit Polyclonal Anti-C19orf18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C19orf18 antibody: synthetic peptide directed towards the N terminal of human C19orf18. Synthetic peptide located within the following region: NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK