Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-KV3.1b
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CKESPVIAKYMPTEAVRVT, corresponding to amino acid residues 567-585 of rat Kv3.1b .? ? Intracellular, C-terminus. |
Rabbit Polyclonal Potassium Channel Kv3.1 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122] |
Rabbit Polyclonal Anti-KCNC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNC1 antibody: synthetic peptide directed towards the N terminal of human KCNC1. Synthetic peptide located within the following region: TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY |
Anti-KCNC1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1 |
Anti-KCNC1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1 |
KCNC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human KCNC1 |
| Modifications | Unmodified |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- KCNC1