Germany
Japan
United Kingdom
China
PPIA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPIA |
Antibodies
View as table Download
Goat Polyclonal Antibody against Cyclophilin A / PPIA
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERFGSRNGKTSKK, from the internal region of the protein sequence according to NP_066953.1; NP_982254.1; NP_982255.1. |
Rabbit Polyclonal Anti-PPIA
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIA antibody: synthetic peptide directed towards the middle region of human PPIA. Synthetic peptide located within the following region: TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Cyclophilin A (PPIA) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PPIA |
Rabbit Polyclonal Anti-PPIA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPIA Antibody is: synthetic peptide directed towards the middle region of Human PPIA. Synthetic peptide located within the following region: NGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE |
Rabbit Polyclonal Anti-PPIA
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIA antibody: synthetic peptide directed towards the N terminal of human PPIA. Synthetic peptide located within the following region: FRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFED |
PPIA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PPIA Antibody
| Applications | WB |
| Conjugation | Unconjugated |
PPIA Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse PPIA |
PPIA rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PPIA |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- PPIA