Germany
Japan
United Kingdom
China
Goat Anti-APOL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ELTQIYQRLNPCHTH, from the C Terminus of the protein sequence according to NP_663615.1, NP_055164.1, NP_663616.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-APOL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APOL3 antibody is: synthetic peptide directed towards the middle region of Human APOL3. Synthetic peptide located within the following region: AIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGC |
Rabbit Polyclonal Anti-APOL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APOL3 antibody is: synthetic peptide directed towards the N-terminal region of Human APOL3. Synthetic peptide located within the following region: DARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQI |
APOL3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human APOL3 (NP_663614.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- APOL3