APOL3 Rabbit Polyclonal Antibody

CAT#: TA331372

Rabbit Polyclonal Anti-APOL3 Antibody

Product Images

Host: Rabbit; Target Name: APOL3; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-APOL3 antibody is: synthetic peptide directed towards the N-terminal region of Human APOL3. Synthetic peptide located within the following region: DARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: apolipoprotein L3
• Database Link:
  NP_663615
  Entrez Gene 80833 Human
  UniProt ID O95236
• Background: This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants.
• Synonyms: apoL-III; APOLIII; CG12_1; CG121
• Note: Human: 100%