APOL3 Rabbit Polyclonal Antibody

CAT#: TA331371

Rabbit Polyclonal Anti-APOL3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "APOL3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-APOL3 antibody is: synthetic peptide directed towards the middle region of Human APOL3. Synthetic peptide located within the following region: AIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name apolipoprotein L3
Background This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants.
Synonyms apoL-III; APOLIII; CG12_1; CG121
Note Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.