Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-ABCD3 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from human ABCD3. |
Rabbit Polyclonal Anti-ABCD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCD3 Antibody: synthetic peptide directed towards the N terminal of human ABCD3. Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD |
Goat Anti-ABCD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDGREDQKRKGISD, from the internal region of the protein sequence according to NP_002849.1. |
PMP70/ABCD3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PMP70/PMP70/ABCD3. |
Active filters
Target Symbol
- ABCD3